General Information

  • ID:  hor000034
  • Uniprot ID:  P86435(589-618)
  • Protein name:  Peptide V
  • Gene name:  VGF
  • Organism:  Bos taurus (Bovine)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0033500 carbohydrate homeostasis; GO:0048167 regulation of synaptic plasticity
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  AQEEAEAEERRLQEQEELENYIEHVLLRRP
  • Length:  30(589-618)
  • Propeptide:  MKSLRLPATVLFCLLLLIKGLGAAPPGHPEAQPPPPSSEHKEPVAGDAVLGSKDVSALEVRAARNSEPQDEGELFQGVDPRALAAVLLQALDRPASPPAPGGSQQRPEEETAESLLTETVRSQTHSLPVPETQAPAAPPRPQTQENGAEAPDPSEELEALASLLQELRDFSPSSAKRQQETAAAETETRTHTLTRVNLESPGPERVWRASWGEFQARVPERAPLPPPAPPQFQARVPESGPLPEAHQFGGGSSPK
  • Signal peptide:  MKSLRLPATVLFCLLLLIKGLGA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Synthesize cells or may act as paracrine agents on neighboring cells
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O44662-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-O44662-F1.pdbhor000034_AF2.pdbhor000034_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 422546 Formula: C157H252N48O56
Absent amino acids: CDFGKMSTW Common amino acids: E
pI: 4.14 Basic residues: 5
Polar residues: 2 Hydrophobic residues: 9
Hydrophobicity: -146 Boman Index: -12177
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 84.67
Instability Index: 14197.33 Extinction Coefficient cystines: 1490
Absorbance 280nm: 51.38

Literature

  • PubMed ID:  7988466
  • Title:  Antifungal innate immunity in C. elegans: PKCdelta links G protein signaling and a conserved p38 MAPK cascade.